PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G16000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 245aa    MW: 26677.8 Da    PI: 6.8681
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G16000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++ ++G g+W++++ + g+ R +k+c++rw +yl
  LPERR04G16000.1 15 KGLWSPEEDQKLRDYILRYGHGCWSAVPVKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding48.81.6e-1569113248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g ++ eE+e   ++++ +G++ W+ Iar ++ gRt++++k++w++yl
  LPERR04G16000.1  69 GMFSREEEETVMNLHATMGNK-WSQIARLLP-GRTDNEVKNYWNSYL 113
                      56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-211065IPR009057Homeodomain-like
PROSITE profilePS5129414.221062IPR017930Myb domain
SuperFamilySSF466891.83E-2813109IPR009057Homeodomain-like
SMARTSM007173.6E-111464IPR001005SANT/Myb domain
PfamPF002491.0E-131562IPR001005SANT/Myb domain
CDDcd001671.06E-101862No hitNo description
PROSITE profilePS5129423.66463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2566117IPR009057Homeodomain-like
SMARTSM007173.8E-1367115IPR001005SANT/Myb domain
PfamPF002497.2E-1469113IPR001005SANT/Myb domain
CDDcd001671.56E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGCKACQKPK VHYRKGLWSP EEDQKLRDYI LRYGHGCWSA VPVKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSREEEETVM NLHATMGNKW SQIARLLPGR TDNEVKNYWN SYLKKRVETA  120
QAATARKSAE PADDVTTGSP NRSEAGQDQR AAADLPASSD SSGPVMFADW FDMDYGTSLA  180
GTAPAGLSHQ GSSVQVDGPC GGGGVDFLHG LGDGGFFWDF DDAAGHMQGG GLSDLLSMSE  240
FLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28151197110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071350.0AK107135.1 Oryza sativa Japonica Group cDNA clone:002-124-C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636234.11e-147PREDICTED: transcription factor LAF1
TrEMBLA0A0D9W7I60.0A0A0D9W7I6_9ORYZ; Uncharacterized protein
STRINGORGLA10G0151700.11e-148(Oryza glaberrima)
STRINGORGLA04G0168700.11e-148(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.17e-60myb domain protein 18